SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003015 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003015
Domain Number 1 Region: 7-267
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.5e-80
Family Eukaryotic proteases 0.0000000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003015   Gene: ENSFCAG00000003268   Transcript: ENSFCAT00000003268
Sequence length 268
Comment pep:novel genescaffold:CAT:GeneScaffold_2478:312819:318902:1 gene:ENSFCAG00000003268 transcript:ENSFCAT00000003268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGFTILAALLACASSCGVPSFLPNLSARVVGGDNARPHSWPWQISLQKIKYGTGNHMWV
GILIANSFGLTAAHCISNTKTYRVALGKNNLVVDNEEGSLFANVDTIFVHEKWNSFLVRN
DIALIKLAEPVQLSDTIQLACLPEKGSLLPQDYPCYVTGWGRLWTNGPIADELQQGLQPV
VDHTTCTQKDWWGSMVKDTMVCAGGDGVISACNGDSGGPLNCQAENGSWEVRGIVSFGSG
LGCNTLKKPTVFTRVSAYIDWINEKMQL
Download sequence
Identical sequences ENSFCAP00000003015 9685.ENSFCAP00000003015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]