SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003187 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003187
Domain Number 1 Region: 801-1049
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-86
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 478-731
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.97e-80
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 3 Region: 341-435
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.54e-34
Family Eukaryotic proteases 0.0062
Further Details:      
 
Domain Number 4 Region: 152-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003187   Gene: ENSFCAG00000003452   Transcript: ENSFCAT00000003453
Sequence length 1050
Comment pep:novel genescaffold:CAT:GeneScaffold_1858:184900:210595:1 gene:ENSFCAG00000003452 transcript:ENSFCAT00000003453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTAGDLQLVPGTAKEVPAPYTSCCRMALCVVVATSIIMVTLGVLMXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHFLLQASQSLSLGLEEELLRQGLRARLQG
HGIPLAAHGTIVSAQLTGSQKAPWTERDLKSGHCPGNTFSCRNGQCVTKVNPECDDRVDC
SDGSDEAHCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKPETLQKATVELLDQGLCAS
LYGHSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV
YARVTRLRDWILEAITTAGRPLAPTAAPASTTASTARPTSPESPTRPTLGLSAAPPDSVT
ASKPQECGARPAMEKPTRIVGGLGAVSGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHG
FNHTKVELVRAHLGTASLTGVGGNPVKMGLKRAVLHPQYNPGILDFDVAVLELAGPLGFN
KYIQPVCLPLAIQKFPVGRKCMISGWGNTQEGNATKPDILQRASVGIIDQKACSALYNSS
LTDRMLCAGFLEGKVDSCQGDSGGPLACEEAPGVFYLAGIVSWGVGCAQARRPGVYARIT
RLKGWILDTMSSGLLPTARTPATSSSGTAAAFTVPGVPASTATPSATSRATSQPANMTAA
TVSATAGGQTPLPDAPRTTVGFQPPDCGLAPVAAMTRIVGGSAAARGEWPWQVSLWLRRR
EHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGAEGQLERVARIYKHPFYNL
YTLDYDVALLELAGPVRRGRLVRPICLPEPTPRPPDGARCVITGWGSVREGGSMARQLQK
AAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTS
WGYGCGRPHFPGVYTRVAAVRGWIGQNIQE
Download sequence
Identical sequences 9685.ENSFCAP00000003187 ENSFCAP00000003187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]