SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003371 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003371
Domain Number 1 Region: 14-177
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.11e-47
Family Prokaryotic proteases 0.00000351
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000003371
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000434
Family HtrA-like serine proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003371   Gene: ENSFCAG00000003656   Transcript: ENSFCAT00000003657
Sequence length 322
Comment pep:novel genescaffold:CAT:GeneScaffold_1054:568415:596189:1 gene:ENSFCAG00000003656 transcript:ENSFCAT00000003657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTN
AHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHEGKLPVLLLGRSSELRPGEF
VVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAITKKKYIGIRMMSLTSSKAKEL
KDRHRDFPDVLSGAYIIEVIPDTPAEAXXXXXXXXXXXXXXXXXXXXXXXXXXXKKESTL
NTVVRRGNEDMMITVIPEEIDP
Download sequence
Identical sequences 9685.ENSFCAP00000003371 ENSFCAP00000003371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]