SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003514 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003514
Domain Number 1 Region: 116-193,243-394
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-28
Family Eukaryotic proteases 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003514   Gene: ENSFCAG00000003811   Transcript: ENSFCAT00000003812
Sequence length 413
Comment pep:novel scaffold:CAT:scaffold_187664:46749:47990:1 gene:ENSFCAG00000003811 transcript:ENSFCAT00000003812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENVLFCWIFFTLGWTLTDGSEMEQDFMWHLRKIPRVVSERTFRLTSPTFKADTKMVLDR
VCGIECQKELPAPSLSDLEDSLSYETVFENGTRTLTRVKVQDVVLEPTQNITTKGALVRR
RRQVYGTDSRFSILDKRFLTNFPFNTAVKLSTGCSGILISPSHVLTAAHCVHDGKDYIKG
SKKLRVGLLKMRNKGGGKKRRGSKRSRREAHGGDKREDTKVNLERDKAGRRRRKESGRGQ
KAAEGKPSFQWTRVKNTHIPKGWARGGRGEAALDYDYALLELKRPHKKKYMELGISPTIK
KLPGGMIHFSGFDRDRADQLVYRFCSVSDESNDLLYQYCDAESGSTGSGVYLRLKEPDKK
NWKRKIIAVYSGHQWVDVHGVQKDYNVAVRITPLKYAQICLWIHGDNANCTYG
Download sequence
Identical sequences ENSFCAP00000003514 ENSFCAP00000003514 9685.ENSFCAP00000003514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]