SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003562 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003562
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.22e-46
Family Eukaryotic proteases 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003562   Gene: ENSFCAG00000003862   Transcript: ENSFCAT00000003863
Sequence length 185
Comment pep:novel genescaffold:CAT:GeneScaffold_28:355800:383448:-1 gene:ENSFCAG00000003862 transcript:ENSFCAT00000003863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLPAVALILLPLWFGTQGAEASSVGRPRMLNRMVDDQDALKGKWPWQVSIQRNGSQFC
GGSLITERWVLNAAHCFSNTSETSLYRVLLGVRQLVKPGPHAVYARVKRVESNPLYQGMA
SSADVALVELEAPVTFSNYILPVCMPDPSVVFEAGMNCWVTGWGSPSEEDRLPNPRVLKL
AVPII
Download sequence
Identical sequences 9685.ENSFCAP00000003562 ENSFCAP00000003562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]