SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003563 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003563
Domain Number 1 Region: 16-238
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-62
Family Eukaryotic proteases 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003563   Gene: ENSFCAG00000003863   Transcript: ENSFCAT00000003864
Sequence length 239
Comment pep:novel genescaffold:CAT:GeneScaffold_27:34261:37562:-1 gene:ENSFCAG00000003863 transcript:ENSFCAT00000003864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVSRIPPALGGGCLRILTPLLLLASAXXXXXXXXXXPPACGKPQRLNRIVGGEDSTDAE
WPWVVSIRKNGTHHCAGSLLTSRWVVTAAHCFKGNLNKPSQFSVLLGAWQLENPGPRSQQ
VGIAWVQSHPVYSWKEGSRADIALVRLEHTIHFSERILPICLPDSSVRLPPNTRCWIAGW
GSIRDGVPLPHPQTLQKLEVPIIDSEVCSRLYWRGAGQGAITEDMLCAGYLEGRRDACL
Download sequence
Identical sequences 9685.ENSFCAP00000003563 ENSFCAP00000003563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]