SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003907 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003907
Domain Number 1 Region: 183-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-25
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000725
Family Kringle modules 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003907   Gene: ENSFCAG00000004240   Transcript: ENSFCAT00000004241
Sequence length 451
Comment pep:novel genescaffold:CAT:GeneScaffold_4324:34815:108554:1 gene:ENSFCAG00000004240 transcript:ENSFCAT00000004241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPGNLGCYKDHGNPPPLTGASKTSNKLTIQTCISFC
RSQRFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLV
GACGGNYSAMTAVVYSPDFPDTYATGRVCYWTIRVPGASHIHFNFTLFDIRDSADMVELL
DGYTHRVLVRFNGRNRPPLSFNVSLDFIILYFFSDRINQAQGFAVLYQAVKEELPQERPT
ANQTLAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSSSQIPPGDGSHGVEGWT
VYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCRQPGTSGEIWTIFYEPSTSIS
IFKKKLKSQSQQDDRNPLAMQDSAVMKLSLP
Download sequence
Identical sequences 9685.ENSFCAP00000003907 ENSFCAP00000003907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]