SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004073 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004073
Domain Number 1 Region: 10-253
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.22e-79
Family Eukaryotic proteases 0.0000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004073   Gene: ENSFCAG00000004411   Transcript: ENSFCAT00000004412
Sequence length 256
Comment pep:known genescaffold:CAT:GeneScaffold_5030:306680:323115:-1 gene:ENSFCAG00000004411 transcript:ENSFCAT00000004412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRFHSTQDFPETNARVVGGTEARKNSWPSQISLQYLSGGKWYHTCGGTLIRQNWVMTAA
HCVDRKMTFRVVAGEHNLSQNDGTEQRVSVQKIVVHPYWNSNNVAAGYDIALLRLAQRVT
LNNYVQLGVLPAAGTILANNNPCYITGWGMTKTNGQLAQALQQAYLPSVDYATCSSSSYW
GSTVKSTMVCAGGDGIRSGCQGDSGGPLHCLVNGKYAVHGVTSFVSSLGCNVSRKPTVFT
RVSAYISWINNVIASN
Download sequence
Identical sequences ENSFCAP00000004073 9685.ENSFCAP00000004073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]