SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004170 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004170
Domain Number 1 Region: 457-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.47e-52
Family Eukaryotic proteases 0.0000154
Further Details:      
 
Domain Number 2 Region: 187-453
Classification Level Classification E-value
Superfamily vWA-like 8.35e-51
Family Integrin A (or I) domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 149-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.00031
Further Details:      
 
Domain Number 4 Region: 23-72
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000361
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004170   Gene: ENSFCAG00000004516   Transcript: ENSFCAT00000004517
Sequence length 744
Comment pep:novel genescaffold:CAT:GeneScaffold_4790:524266:535078:1 gene:ENSFCAG00000004516 transcript:ENSFCAT00000004517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMAFLCLLSLYPGLAAATPSCPQNVNISGGTFTLSHGWAPGSVLTYSCPVGRYPVPA
SRLCKSNGRWQTLRSTQLTKAVCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXGYCPNPGISVGAVRTGSRFGLGDKVTYRCSSNL
VLTGSAERECQSNGVWSGTEPICRQPYSYDFPEDVAPALGASLSHLLGATNPTQKKKKSV
GRKIQIQRSGHLNLYLLLDASQSVAEDDFHIFKESASLMVDRIFSFEINVSVAIITFASK
PKIIMSVLHDNSRDATEVINSLDNVNYKDHENGTGTNTYAALDSVHIMMNNQMQRLGMST
AAWQEIRHAIILLTDGKSNMGGSPKLAVDNIKEILNINQQRNDYLDIYAIGVGKLDVDWK
ELNELGSKKDGERHAFILQDTNALYQVFEHMLDVSKLTDTICGVGNMSANASAQERTPWH
VTIKPKSQETCRGALISDQWVLTAAHCFRHAENSSLWRVNVGDPNSQWGKDFSIEKAVIS
SGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTVEANLALRRPPGSTCR
DHESELLNKLSVPAHFVALNGSKLNINLKTGTEVVSQDRTTFPDLTDVREVVTDQFLCSG
TENDDNPCRGESGGAVFLERRYRFFQVGLVSWGLYNPCGNSNKNSRQKAPRGKIPPPRDF
HINLFRLQPWLRQHLEGILNFLPL
Download sequence
Identical sequences 9685.ENSFCAP00000004170 ENSFCAP00000004170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]