SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004171 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004171
Domain Number 1 Region: 202-471
Classification Level Classification E-value
Superfamily vWA-like 8.01e-62
Family Integrin A (or I) domain 0.0000000119
Further Details:      
 
Domain Number 2 Region: 474-761
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.86e-58
Family Eukaryotic proteases 0.000000000592
Further Details:      
 
Domain Number 3 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0000414
Further Details:      
 
Domain Number 4 Region: 98-159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000433
Family Complement control module/SCR domain 0.0000421
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000598
Family Complement control module/SCR domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004171   Gene: ENSFCAG00000004517   Transcript: ENSFCAT00000004518
Sequence length 767
Comment pep:novel genescaffold:CAT:GeneScaffold_4790:535672:541858:1 gene:ENSFCAG00000004517 transcript:ENSFCAT00000004518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSLSPQLCLVFLVLGLLSGGGSIPPLTVVGPQGSCSLEGVEIKGGSFRLLKEGQALEY
VCPSGFYPYPVQIRTCRSTGSWSTLRTQDQKIVKTAECRAIRCPRPQGFENGEYWPRTPY
YNLSDEISFRCYDGYTLRGSANRTCQATGRWDGQTAICDDGAGYCPNPGIPLGTRKVGNH
YRLEDRVTYYCNRGLTLRGSQQRTCQEGGSWSGTEPSCQDSFMYDIPEEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIILDPSGSMNIYLVLDASDSIGIGNFTRAKNCLKDFIEKV
ASYGVKPKYGLVTYATVPKILIRVSDENSSDADWVTRAIDNINYEDHKLKAGTNTKKALQ
AIYNMMSWPGNQPPEGWNRTRHVIILMTDGLHNMGGDPVSVIHEIRSLLDIGRDRKNLRE
DYLDVYVFGVGPLVNQENINALASKKDKEQHVFKVKDMEDLEDVFKQMLDETRTLGLCGM
VWEHKKGSDYHKQPWQAKISVTRPLKGHETCMGAVVSEYYVLTAAHCFTVDDQNHSIKVS
VGGMKQDLEIDKVLFHPNYDINGKKAEGIPEFYDYDVALIRLKEKLKYGQTLRPICLPCT
QGTNQALRLPLSTTCQQQMEELLPAKDVKALFVSELSKDRKSMIRKEVYIKNGEKKSSCE
RDAQYALGYDKVKDISKVVTPRFLCTGGVDPYTDPNTCKGDSGGPLIIHKRSRFIQVGVI
SWGVVDVCKDQRRWRQVPAHARDFHINLFQVLPWLREKLKEEDLDFL
Download sequence
Identical sequences XP_003986000.1.62641 ENSFCAP00000004171 9685.ENSFCAP00000004171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]