SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004354 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004354
Domain Number 1 Region: 8-277
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-88
Family Eukaryotic proteases 0.0000917
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004354   Gene: ENSFCAG00000004712   Transcript: ENSFCAT00000004713
Sequence length 280
Comment pep:novel genescaffold:CAT:GeneScaffold_571:79134:80986:-1 gene:ENSFCAG00000004712 transcript:ENSFCAT00000004713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGASRLQLLPLLLLLGAPGTPDSAACGQPQVSSRIVGGRDARDGQWPWQASIQHRGAHV
CGGSLIAPQWVLTAAHCFPRRVLPSEYRVRLGALRLGSASPRALSAPVRRVLLPPDYSEG
GGRGDLALLQLSRPVSLSARIQPVCLPEPGARPPLRAPCWVTGWGSLHPGVPLPEWRPLQ
GVRVPLLDARTCDRLYHVGTSVPRAEHIVLPGNLCAGYVEGHKDACQGDSGGPLTCVTSG
RWVLVGVVSWGKGCALPNRPGVYTNVATYSPWIRARLSNQ
Download sequence
Identical sequences ENSFCAP00000004354 9685.ENSFCAP00000004354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]