SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004578 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004578
Domain Number 1 Region: 234-425
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.89e-33
Family Reprolysin-like 0.0061
Further Details:      
 
Domain Number 2 Region: 524-579
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000068
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 951-989
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000392
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004578   Gene: ENSFCAG00000004945   Transcript: ENSFCAT00000004950
Sequence length 1175
Comment pep:novel genescaffold:CAT:GeneScaffold_3055:7639:298161:-1 gene:ENSFCAG00000004945 transcript:ENSFCAT00000004950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGNEEMVQIDLPKLKRQREYELVTPVSTDFEGHYLSHILSANHKKRSTRDVSSNSEQLFF
NITAFGRDFHLRLKRNTQLVAPGAVVEWHETSLVPGNITNPNNDHQAGNASERIWKTEPL
QTNCAYVGDIMDIPGTSVAISNCDGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSDLEGLDDVDTISSSIEQQLKEAARRRRHAGENDYNIEVLL
GVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVHMNVVLVRMIMLGYAKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXHDHAIFTRDFGAMQGYAPVTGMCHPVRSCTLNH
EDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETAMGSVMAPLVQAAFHRYHWSRCSGQEL
KRYIXXXXXXXXXXXXXXXXXXXXXXXXNYSMDEQCRFDFGVGYKMCTAFRTFDPCKQLW
CSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHCMWKNANQQKQDGNWGSWTKFGSCSRT
CGTGVRFRTRQCNNPTPINGGQDCPGVNFEYQLCNTEECQKHFEDFRGQQCQQRNSHFEY
HNTKHHWLPYEHPDSKKRCHLYCQSRETGDVVYMKQLVHDGTHCSYKDPYSICVRGECVK
VGCDKEIGSNKVEDKCGVCGGDNSHCRTVKGTFTRTPRKLXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSVTCGEGT
EVRQVLCRAGDHCAGEKPQSSRACQLPPCHDEPCLGDKSIFCQMEVLARYCSIPGYNKLC
CESCSKRSSTLPPPYLPEAAETHDDAIFNPSDLPGSLAVPTSLVPYHSEPPAEKKSLSRI
SSVGGPNAVTASRPNSKPDGANLPQRRAQQVGSKTLRLASPPAKSGHLNSSSEMAAAHFL
AVSDSIGASSQARTSKKDEKIIDKRRPIRSPTLER
Download sequence
Identical sequences 9685.ENSFCAP00000004578 ENSFCAP00000004578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]