SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004723 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004723
Domain Number 1 Region: 641-877
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-75
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 283-385
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 389-445,556-583
Classification Level Classification E-value
Superfamily SRCR-like 5.76e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 4 Region: 102-171
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000459
Family Kringle modules 0.0056
Further Details:      
 
Domain Number 5 Region: 223-273
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000719
Family Scavenger receptor cysteine-rich (SRCR) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004723   Gene: ENSFCAG00000005100   Transcript: ENSFCAT00000005100
Sequence length 878
Comment pep:novel genescaffold:CAT:GeneScaffold_3380:310098:498102:-1 gene:ENSFCAG00000005100 transcript:ENSFCAT00000005100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFVVALVLGALPEVVGFDLVLRYPLHHRYRHSLPPGPPHPYYLPTQQRQQRTPLSP
SLPRVPRVPRPPPALHAQRLHALHAGRTPGPHPGDCPAGEPWVNVTDFGAPCLLWAEVPP
FLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGNAHGKVDWGYCDCRHXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKGVAKQTPFSGLGLIPIYWSNV
RCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPAFPVIRLVGGSSAREGRVELYH
AGQWGTVCDDQWDEADAEVICRQLGLSGIAKAWNQAYFGEGSGPIMLDEVRCTGNELSIE
QCPKSSWGEHNCDHKEDAGVSCTPLTDGVIRLGGGKGSHEGRLEVYYRGRWGTVCDDGWT
ELNTYVVCRQLGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGWPWQVSLRLKSSHGDG
RLLCGATLLSSCWVLTAAHCFKXXGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHRE
YRPDSSDYDIALVRLEGPEEQCVRFSSHVLPACLPLRRERPQKTASNCYITGWGDTGRAY
SRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCVRSGES
WVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences ENSFCAP00000004723 9685.ENSFCAP00000004723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]