SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004796 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004796
Domain Number 1 Region: 146-252
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.04e-19
Family Platelet-derived growth factor-like 0.012
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000183
Family Spermadhesin, CUB domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004796   Gene: ENSFCAG00000005174   Transcript: ENSFCAT00000005175
Sequence length 260
Comment pep:novel genescaffold:CAT:GeneScaffold_3807:88365:188884:-1 gene:ENSFCAG00000005174 transcript:ENSFCAT00000005175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDFVEVEDVSETSTVIRGRWCGHKDAPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFV
XXXXXXXXXXXXXXXXXXXXXGVSYHSPSVTDPTLTADALDKTVAEFDTVEDLLKHFNPE
SWREDLENLYLETPHYRGRSYHDRKSKVDLDRLNDEVKRYSCTPRNYSVNLREELKLTNV
VFFPRCLLVQRCGGNCGCGTVSWKSCSCNSGKTVKKYHEVLQFEPGHFRRRARAKHMALV
DIQLDHHERCDCVCSSRPPR
Download sequence
Identical sequences 9685.ENSFCAP00000004796 ENSFCAP00000004796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]