SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005146 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005146
Domain Number 1 Region: 204-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-81
Family Nuclear receptor ligand-binding domain 0.000000000147
Further Details:      
 
Domain Number 2 Region: 99-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.79e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005146   Gene: ENSFCAG00000005547   Transcript: ENSFCAT00000005549
Sequence length 468
Comment pep:novel genescaffold:CAT:GeneScaffold_1879:217966:301795:1 gene:ENSFCAG00000005547 transcript:ENSFCAT00000005549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFSFTEYQYLGSG
PGSDGSVITDTLSPASSPSSVTYPVAPGGADEPSSVALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLAYDKCDRSCKIQKKNRNKCQYCRFHKCLSAGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDPEDAETADLKSLAKRIYEAYLKNFNMNKVKARVILAGKANNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLKLHLQSNHPDNI
FLFPKLLQKMADLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
Download sequence
Identical sequences M3W486
XP_003989443.1.62641 XP_019691290.1.62641 ENSFCAP00000005146 9685.ENSFCAP00000005146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]