SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005206 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005206
Domain Number 1 Region: 9-198
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.74e-51
Family Eukaryotic proteases 0.000000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005206   Gene: ENSFCAG00000005607   Transcript: ENSFCAT00000005609
Sequence length 200
Comment pep:known genescaffold:CAT:GeneScaffold_5149:688906:691114:-1 gene:ENSFCAG00000005607 transcript:ENSFCAT00000005609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCLPLALPLLLLCSRAKAGEIIGGTECKPHSRPYMAHLEIVTLQNRLLFCGGFLIRRNF
VLTAAHCAGRSIMVTLGAHNIKKKEDTWQKLEVIKQFPHPKYDDCTFLHDIMLLKLKEKA
NLTLAVGTLPLPPQFNVIPPGRMCRVAGWGRTQVNEPGSDTLREVKQRLMNPQACRHYRT
FDHNFQLCVGNPRKTKSAFE
Download sequence
Identical sequences ENSFCAP00000005206 9685.ENSFCAP00000005206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]