SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005307 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005307
Domain Number 1 Region: 323-565
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-81
Family Eukaryotic proteases 0.000055
Further Details:      
 
Domain Number 2 Region: 207-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000903
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 1-86
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000113
Family Spermadhesin, CUB domain 0.0077
Further Details:      
 
Domain Number 4 Region: 243-279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000353
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005307   Gene: ENSFCAG00000005715   Transcript: ENSFCAT00000005717
Sequence length 569
Comment pep:novel genescaffold:CAT:GeneScaffold_3865:344206:375234:1 gene:ENSFCAG00000005715 transcript:ENSFCAT00000005717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHFSLVAVVGYLIHLSIESVPIEAACVTDSLTIYDSLMPLRSTVLICEPTRTIMSFVST
NNLMLVAFKSPQIRRLSGIRAFFEVIPEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXTSLSTLGVALKFHNYSITKKSVKGCDHGWWEINEQMYCGSYMDHQTIFRVPSS
LAHIQLHCSSRLSDKPLLVEYGSYNISQPCPVGSFRCSSGLCVPQTQRCDGVNDCFDESD
ELFCVTLKPACNTSSLRQHGPLVCDGFRDCEDGRDEQNCTQSIPCNNRTFKCGNDICFRK
QNAQCXXXXXXXXXXXXXXXXCSKSLSTHHRIIGGTDTQEGGWPWQVSLHFVGSAYCGAS
VISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFVSPVKRIVVHEYYNSQTFDYD
IALLQLSTAWPETLKQLIQPICIPPAGQKVRGGEKCWVTGWGRRHEADNKGSPVLQQAEV
ELIDQTLCVSTYGIITSRMLCAGVMSGKRDACRGDSGGPLSCRRKSDGKWILTGIVSWGH
GCGRPDFPGVYTRVSNFVSWIRKYVPSLS
Download sequence
Identical sequences 9685.ENSFCAP00000005307 ENSFCAP00000005307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]