SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005411 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005411
Domain Number 1 Region: 157-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-55
Family Eukaryotic proteases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005411   Gene: ENSFCAG00000005828   Transcript: ENSFCAT00000005830
Sequence length 420
Comment pep:known genescaffold:CAT:GeneScaffold_4505:255489:284286:1 gene:ENSFCAG00000005828 transcript:ENSFCAT00000005830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPHSTALPTAGQTKMRALGAVVALLFWGQLFAVETGNEATDNTXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGKPKNPVDQVQRIMGGS
VDAKGSFPWQAKMVSHHNLTSGATLISEQWLLTTAKNLFLGHKDDAKAKDIAPTLKLYVG
KNQPVEIEKVVLHPNYSNVDIGLIKLKQKVPIDERVMPICLPSKDYAEVGRVGYVSGWGR
NTNFNFTELLKYVMLPVADQENCVKHYEGSTVPEKKSSKSPVGVQPILNEHTFCAGLSEF
QEDTCYGDAGSAFAVHDEDDNTWYAAGILSFDKSCRVAEYGVYVKVPSILAWIQETTAGN
Download sequence
Identical sequences 9685.ENSFCAP00000005411 ENSFCAP00000005411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]