SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005470 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005470
Domain Number 1 Region: 748-859
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-22
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 223-344
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 570-710
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000576
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 185-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000387
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 34-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000126
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 1-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000798
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 90-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000524
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005470
Domain Number - Region: 131-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005470   Gene: ENSFCAG00000005888   Transcript: ENSFCAT00000005891
Sequence length 936
Comment pep:novel genescaffold:CAT:GeneScaffold_1696:1390496:1415666:1 gene:ENSFCAG00000005888 transcript:ENSFCAT00000005891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNM
MGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFEL
TKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHVKFVLHTDKTCIXXXXXXXXXXXXXX
XXXTCAVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNT
VGSFECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHHGYLLYGVTHC
GDVDECSINRGGCRFGCINTPGSYQCTCPTGQGRLHWNGKDCTEPVKCQSSPGASKAMLS
CNRSGKKDTCALTCPSRARFLPESENGFTVSCGTPSPRATPARAGHTGNSTNSNHCHEAA
VLSVKQRASFKIKDAKCRLHLRNKGKTEEASRIPGPGGAPCSDCQITFIHLKCDSSRKGK
GRRARTPPGKEVTRLTLELEAEVRAEETTAGCGLPCLRQRMERRLKGSLKMLRKSINQDR
FLLRLAGLDYELAHKPGPGAGERAEPAEACRPGQHRAGAKCVSCPQGTYYHGQTEQCVPC
PAGTFQEREGQLSCDLCPGSDAHGPLGATKVTTCAGQCSPGQYSVDGFKPCQPCPRGTYQ
PEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTTIHRGIRCAMGSYQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXRQCGGELGEFTGYIESPNYPGNYPAGVECVWNIN
PPPKRKILIVVPEIFLPSEDECGDVLVMRKNSPSSITTYECQTYERPIAFTARSRKLWIN
FKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLA
HPQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences 9685.ENSFCAP00000005470 ENSFCAP00000005470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]