SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005473 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005473
Domain Number 1 Region: 432-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.73e-55
Family Eukaryotic proteases 0.00065
Further Details:      
 
Domain Number 2 Region: 125-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 3 Region: 297-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000103
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000356
Family EGF-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005473   Gene: ENSFCAG00000005892   Transcript: ENSFCAT00000005894
Sequence length 737
Comment pep:novel genescaffold:CAT:GeneScaffold_145:447617:575667:-1 gene:ENSFCAG00000005892 transcript:ENSFCAT00000005894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXCGQVLRASKGQILLESYPLNAHCEWTIHAKPGFIIQLRFIMLSLEFDYMCQYD
YVEVRDGDSSNGRIIKRFCGNERPAPIRSTDSSLHILFHSDGSKNFDGFHAVFEEITACS
SSPCFHDGTCLLDKTGSYKCACLAGYTGQHCENXXXXXXXXXXXXXXXXXXLEERNCSDP
GGPVNGYKKITGGPGLINGHYAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICI
KACREPKISDLVRRKVLPMQVQSRETPLHQLYSASFSKQKLQGAPTKKPALPFGDLPPGF
QHLHTQLQYECVSPFYRRLGSSRRTCLRTGKWSGRAPSCIPICGKTENIAAPKTQGMRWP
WQAAIYRRASGVHGGSLHKDAWFLVCSGALVNERTVVVAAHCVTDLGRVTMIKTADLRVV
LGKFYRDDDREEKTIQSLRISAVILHPNYDPILLDTDIAILKLLDKARVSTRVQPICLAA
PRDLSTSFQESRITVAGWNVLSDARSPGFKNDTLRSGVVRVVDSLLCEEQHEDHGIPVSI
TDNMFCASRDPAAPSDICTAETGGIAAVSFPGRASPEPRWHLVGLVSWSYDKTCSHGLYT
AFSKVLPFKDWIERNMK
Download sequence
Identical sequences 9685.ENSFCAP00000005473 ENSFCAP00000005473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]