SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005691 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005691
Domain Number 1 Region: 850-1035
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-54
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 453-574
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.96e-35
Family Frizzled cysteine-rich domain 0.00014
Further Details:      
 
Domain Number 3 Region: 654-693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 341-378
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 579-615
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 269-305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 207-235
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000379
Family Frizzled cysteine-rich domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005691
Domain Number - Region: 711-740
Classification Level Classification E-value
Superfamily SRCR-like 0.000863
Family Scavenger receptor cysteine-rich (SRCR) domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005691   Gene: ENSFCAG00000006125   Transcript: ENSFCAT00000006126
Sequence length 1042
Comment pep:novel genescaffold:CAT:GeneScaffold_2614:150034:491253:-1 gene:ENSFCAG00000006125 transcript:ENSFCAT00000006126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKQSPALAREERYRPAGAPEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXTLKKAYFKSNGTEPLVTDGEVPVSDIVLTNTICNKSTVTSATHPNQHVPA
WTTDASLPGNQNHRNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXHGLLPCRSFCEAAKEGCESVLGMVNASWXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLCGGGESFLCASGYCVPRKLQCNGHNDCNDWSD
EEHCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCNPTKEHRCGDGRCIAIEW
VCDGDHDCVDKSDEVNCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTP
CQEGDQRCLYNSCLDSCGGSSLCDPNNSLNNCSQCEPITLELCTNLPYNHTNYPNYLGHR
TQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTSQRIPPCRALCEHSKEHC
ESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEDVEECSPSHFKCGSGRCVLASRRCD
GQADCDDDSDEENCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFCQDDEL
ECANHECVSRERWCDGEADCLDSSDEWDCVTLSKNVSSSSFLTAHRSAKEHHVCADGWHE
TLSQLACKQMGLGEPSVTKLVQGQEQDQEWLTLHSNWESLNGTTLHELLVKGQPCQSRXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXRESAAVWKVVFGINNLDHPSTFMQTRLVRTIILHPRYSRAVVDYDISIVELSE
DINETIYVRPVCLPGTEQSLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEQCQSYFD
MKTITTRMICAGYESGTVDSCMGDSGGPLVCERSGGQWTLFGLTSWGSVCFSKVLGPGVY
SNVSYFVEWIERQIYIHTFLLN
Download sequence
Identical sequences 9685.ENSFCAP00000005691 ENSFCAP00000005691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]