SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005785 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005785
Domain Number 1 Region: 444-584
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.57e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000172
Further Details:      
 
Domain Number 2 Region: 327-424
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.03e-28
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000344
Further Details:      
 
Domain Number 3 Region: 688-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-26
Family MAM domain 0.0027
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000262
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005785   Gene: ENSFCAG00000006226   Transcript: ENSFCAT00000006228
Sequence length 922
Comment pep:novel genescaffold:CAT:GeneScaffold_691:187834:446733:-1 gene:ENSFCAG00000006226 transcript:ENSFCAT00000006228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGLPLLCAALAVAFAPASAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
DPYQRIMINFNPHFDLEDRDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRID
ISSNGEDWITIKEGNKPVIFQGNTNPTDVVFGVFPKPLITRFVRIKPVTWETGISMRFEV
YGCKITXXXXXXXXXXXXXXXXXXQITASNQGDRNWMPENIRLVTSRSGWALPPAPHPYI
NEWLQVDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFE
GNNNYDTPELRTFPPLSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVD
ECDDDQANCHSGTGDDFQLTGGTTVLTTEKPTIIDSTIQSXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXDGNFIYSQADENQKGKVARLVSPVVYSQNSAHC
MTFWYHMSGSHVGTLRVKLHYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIF
EGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKRNPENKIDETGSTPGYEGTGESNE
NISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNF
ELVDGVKLKKDKLNTQSTYSEA
Download sequence
Identical sequences 9685.ENSFCAP00000005785 ENSFCAP00000005785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]