SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005790 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005790
Domain Number 1 Region: 240-503
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-79
Family Nuclear receptor ligand-binding domain 0.000000000288
Further Details:      
 
Domain Number 2 Region: 161-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000489
Family Nuclear receptor 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005790   Gene: ENSFCAG00000006231   Transcript: ENSFCAT00000006233
Sequence length 505
Comment pep:novel genescaffold:CAT:GeneScaffold_3085:516684:639599:1 gene:ENSFCAG00000006231 transcript:ENSFCAT00000006233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETLGDSLIDPESDSFADTLSASTSQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHSF
DIKPFTTVDFSSISTPHYEDLPFARADPMVADYKYDLKLQEYQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSXXXXXXXXXLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Download sequence
Identical sequences ENSFCAP00000005790 9685.ENSFCAP00000005790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]