SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005858 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005858
Domain Number 1 Region: 62-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 2 Region: 129-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000398
Family VWC domain 0.079
Further Details:      
 
Domain Number 3 Region: 217-261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005858   Gene: ENSFCAG00000006305   Transcript: ENSFCAT00000006307
Sequence length 270
Comment pep:novel genescaffold:CAT:GeneScaffold_1275:328695:341348:1 gene:ENSFCAG00000006305 transcript:ENSFCAT00000006307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRLLSPLLVPGDMRELLLSTLLGAALAQFCCRAQGGGPSDTPPEGRPGETSEVHQRKQFC
HWPCQCPRQKPSCPPGVSLLRDGCGCCKVCARQAGDMCNEADLCDPHKDLYSYYSANMIR
GIGEYLIAVGCEFNRVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKPADGHCSGAKGR
KKSDQSNCGLGPFQQQLSTSYKTMPAYRNLPLIWKRKCLVQATKWTPCSRTCGMGISDRV
TNENSNCEMRKEKRLCYIQPCDSNISKRIK
Download sequence
Identical sequences 9685.ENSFCAP00000005858 ENSFCAP00000005858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]