SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006034 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006034
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-30
Family Eukaryotic proteases 0.000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006034   Gene: ENSFCAG00000006495   Transcript: ENSFCAT00000006497
Sequence length 190
Comment pep:novel scaffold:CAT:scaffold_39654:360:1362:1 gene:ENSFCAG00000006495 transcript:ENSFCAT00000006497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQHHSAKTLKGEACEPHSQPRQAALLERGRFNCGVSLSASRMLSAAHRHTGFMSVHLGEH
NLRKRDGPEVLRTAARLVPHPCHEARSHRHDVMLPRLTRPTCLFPQVRPVALPTRCPQPG
KACVVSGWGLVADDKPGTKGSARSQVSLPDMLHCANISVIPATSCSKDYPGRLMSTVCAG
VEGRGTDSCE
Download sequence
Identical sequences ENSFCAP00000006034 9685.ENSFCAP00000006034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]