SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006107 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006107
Domain Number 1 Region: 25-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.97e-36
Family Eukaryotic proteases 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006107   Gene: ENSFCAG00000006573   Transcript: ENSFCAT00000006575
Sequence length 235
Comment pep:novel genescaffold:CAT:GeneScaffold_986:82822:86824:-1 gene:ENSFCAG00000006573 transcript:ENSFCAT00000006575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFIFYLGVLAGTVFSTHASVQKDDHAPYLVYLKSHFNPCVGVLIKNNWVLAPAHCYLPX
XXXXXXXXXXXXXXXXEQTINPIQIIRYWNYSHSAPQDDLMLIKLAKPANFNNKVQPLSL
ATSNVRPGTVCLLSGLDWSQDNNGRHPDLRQNLEAPVMSDKDCQKTEQGKSHRNSLCVKF
VKVFSRIFGEVAVATVICKNKLQGIEVGHFMGGDVGIYTNVHKYTSWIENITKDK
Download sequence
Identical sequences ENSFCAP00000006107 9685.ENSFCAP00000006107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]