SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006127 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006127
Domain Number 1 Region: 41-275
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.79e-46
Family Eukaryotic proteases 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006127   Gene: ENSFCAG00000006597   Transcript: ENSFCAT00000006599
Sequence length 393
Comment pep:novel genescaffold:CAT:GeneScaffold_863:64970:79770:-1 gene:ENSFCAG00000006597 transcript:ENSFCAT00000006599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSAAVHFGDGKMRRMLLVLLYVSHSSASCGIQKVLWKLEEGLVKDQEFPWVVSLQDSQY
THLAFGSILSEFWIISIASALQNRKDIIVIVGIAKMDAKVIAHEEYPVNTIIIHEDFDNE
TMNNNIALLKTDTAMQFSNLVRPICFLGRKLHMPPALQNCWVAGWNPTSATGNHMTMSIL
RKISVKDINMCPLHKLKKTGCGNHIEQETDAVCLGDPGNPMMCQLQQQNLWVLRGVLSHG
GEKCPGFLLYLKVEDYGDWIMSKTKKTSHPLSAFHHWENLLPSLSYKEHFTVTQRKHSGL
GQGGWSLAHVQGQKKTDVYSLPANSSRKSPDIGRKGLRELGRTSVVDIQPMYYDYYGGDS
GEGRGPISGQNRLHQPQEITLFFFVLVFFCNGI
Download sequence
Identical sequences ENSFCAP00000006127 9685.ENSFCAP00000006127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]