SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006158 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006158
Domain Number 1 Region: 190-302
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-17
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 
Domain Number 2 Region: 397-434
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 138-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 4 Region: 34-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000262
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 5 Region: 328-352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000681
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000006158
Domain Number - Region: 355-396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00114
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006158   Gene: ENSFCAG00000006628   Transcript: ENSFCAT00000006630
Sequence length 712
Comment pep:novel genescaffold:CAT:GeneScaffold_3026:207042:211401:1 gene:ENSFCAG00000006628 transcript:ENSFCAT00000006630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTTLLLLLLGGAVAYPDRIIFPNPACEDPPAVLLEVQGTLQRPLRDSRSSPANCTWLI
LGSKEQTVTVRFQKLRLACGSERLILSSPLQPQISLCEAPASPLQLPGGNVTITYSYAGA
RAPVGQGFLLSYSQDWLMCLEEEFQCLNHRCVPLAQRCDRIDACGDGSDEAGCSSDPFPD
LTPAPVPTPPCNHTLEDFYGVFSSPGYSHLASGSHPQSCLWLLDPHDGRRLAVRFTALDL
GYGDAVHVYDGPGPPKTPRLLRSLTHFSNGKSVTVETLSGQAIVAYHTVAWSHGRGFNAT
YHVRGYCLPWDRPCGLGTGLGASEGLGERCYSEAQRCDGSWDCADGTDEENCPGCPPGHF
PCGPAGTTSTTACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQ
PDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLS
RMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGA
SGARRRQRGRSMRRLVRRLRRWGLLPRTNPPARNPETRSQVTPSAAPLESLDGNTGPARE
GGAEGGQDGEQAPPLPVKAPLPSTSTSPALPTISEAPGPLPSTSPESSLLSGVVQALRGR
LLPSLRPPGPTRTPPEPHTTVLSPEDEDDVLLVPLAEPGVWVVEAEDEPLLA
Download sequence
Identical sequences M3W682
9685.ENSFCAP00000006158 XP_003987504.1.62641 ENSFCAP00000006158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]