SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006352 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006352
Domain Number 1 Region: 36-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-34
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 2 Region: 319-444
Classification Level Classification E-value
Superfamily TIMP-like 2.98e-33
Family Netrin-like domain (NTR/C345C module) 0.000000856
Further Details:      
 
Domain Number 3 Region: 158-271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.53e-17
Family Spermadhesin, CUB domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006352   Gene: ENSFCAG00000006843   Transcript: ENSFCAT00000006845
Sequence length 453
Comment pep:novel genescaffold:CAT:GeneScaffold_1002:85768:90744:1 gene:ENSFCAG00000006843 transcript:ENSFCAT00000006845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPATASLLGPLLTAWALLPFAQGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPNK
ECIWTITVPEGQTVSLSFRVFDFELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPLV
APGNQVTLRMTADEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDYP
PGISCSWHIIAPPDQDISVTFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XTISSEGNELLVQFVSDLSVTADGFSASYKTLPRGAAKEAPRAPGRMPGRVPRSSPGPKP
GLPSEEKPKATPGGPDVPSVPCPKQCRRTGTLQSNFCTSNLVVTATVKSMVRGPGEGLTV
TVSLIGAYKTGGLDLPSPLTDTPLKFYVPCKQCPPMKKGVSYLMMGQVEENRGPTLPPES
FVVLYRSNQDQILTNLSKRKCPSQPVRAAGSQA
Download sequence
Identical sequences ENSFCAP00000006352 9685.ENSFCAP00000006352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]