SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006535 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006535
Domain Number 1 Region: 397-501
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-21
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 571-678
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-20
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 3 Region: 684-749
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 743-805
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000945
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 810-869
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000021
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 330-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000375
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 213-331
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000123
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 
Domain Number 8 Region: 506-570
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000128
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006535   Gene: ENSFCAG00000007044   Transcript: ENSFCAT00000007046
Sequence length 967
Comment pep:novel genescaffold:CAT:GeneScaffold_1956:110585:134175:-1 gene:ENSFCAG00000007044 transcript:ENSFCAT00000007046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSEAPTTGEGQAPGIEETDGELTVAPTPEQPERGVHFVTTAPTLKLLNHHPLLEEFLQE
GLEGGEAGLRPALPFQPDPPTPFTPSPLPRLANQDSRPVFTSPTPAMAAAPTQPQSRERP
WSLESEAPVLRITAPLPPVPTPGPGERPSTTPPSRAWTPTQEGPGDMGRPWAPEVGPQTT
GLGMEGTVATSTASGDDEETTATIITTTITTVQPPGPCSWNFSGPEGSLDSPMAPSSPID
VGLDCFYYISVYPGYGVEIKVQNISLREGEVVTVEGLGGPDPLPLANQSFLLRGQVIRSP
THQAALRFQSLPPPAGPGTFHFHYQAYLLNCHFPRRPAYGAVTVTSLHPGGSARFRCATG
YQLKGARILTCLNATQPFWDAQEPVCIGKCPGVTRNATTGRIVSPGFPGNYSNNLTCHWL
LEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEYLPIEGLLSSGRHFF
VELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPSYPVGTTVEFSCDPGYTLE
QGSIIIECIDPHDPQWNETEPACRAVCSGEITDSAGVVLSPNWPEPYSRGQDCIWGVHVE
EDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLGQYSGPRGHFKLFTSMADVTIQFQSDP
GASVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPELVHGTVVTYQCYPGYQVVG
SSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSRRLISSPKFPVGATVQYICDQGFVLT
GSAILTCHDRQASSPKWSDRAPKCLLEQLKPCHGLSAPENGAHSPEKRLHPAGATVHFSC
APGYVLKGQASIKCVPGHPSHWSDPPPICSAASLDGFYSGRSLDXXXXXXXXXXXDAAHI
AAAISLPLVVMALVGGVYLYFSRLQGKSPLRLPQTRPRPYDRITVESAFDNPTYEIGSLY
FAGDERI
Download sequence
Identical sequences ENSFCAP00000006535 9685.ENSFCAP00000006535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]