SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006767 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006767
Domain Number 1 Region: 247-459
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.78e-75
Family Eukaryotic proteases 0.0000000393
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 8.44e-26
Family GLA-domain 0.0000968
Further Details:      
 
Domain Number 3 Region: 134-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000682
Family EGF-type module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006767   Gene: ENSFCAG00000007298   Transcript: ENSFCAT00000007300
Sequence length 461
Comment pep:known genescaffold:CAT:GeneScaffold_830:74662:108523:1 gene:ENSFCAG00000007298 transcript:ENSFCAT00000007300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLNMIMAEPPGLITICLLGYLLGADCTVFLDHEDATKVLSRPKRYNSGKLEEFVQGNL
ERECMEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGICKDDINSYECWCQ
TGFEGKNCELDVTCNIKNGRCKQFCKLDADNKVVCSCTTGYQLAEDQKSCEPAXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVLLKGKIDAFCGGSIINEKWVVTAAHCINPDVEITVVAGEHNTEETEHTEQKRNVIRTI
LHHSYNASVNKYSHDIALLELDEPLTLNSYVTPICVADREYTNTFLKFGYGYVSGWGKVF
NKGRPATILQYLKVPLVDRATCLRSTKFTIYNNMFCAGFHEGGKDSCQGDSGGPHVTEVE
GINFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Download sequence
Identical sequences ENSFCAP00000006767 9685.ENSFCAP00000006767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]