SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006775 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006775
Domain Number 1 Region: 75-223
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.28e-31
Family Eukaryotic proteases 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006775   Gene: ENSFCAG00000007307   Transcript: ENSFCAT00000007309
Sequence length 225
Comment pep:novel genescaffold:CAT:GeneScaffold_4716:12064:14515:1 gene:ENSFCAG00000007307 transcript:ENSFCAT00000007309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTYSHLLGGSALAPVSLAVSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXNFRSVVAVLGAHDLRRREPTRQMFTIQRVFENGFDPQRLLNDIVIL
QLNGSATINSNVRVARLPAQNQGVGSGVQCLAMGWGQLGNPATANILQELNVTVVTTLCP
RSNVCTLVPRRQAGICFGDSGGPLVCNGLIQGIDSFIRGSCGSCF
Download sequence
Identical sequences 9685.ENSFCAP00000006775 ENSFCAP00000006775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]