SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006823 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006823
Domain Number 1 Region: 130-189
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000082
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 194-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000904
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 6-67
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000598
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 4 Region: 67-128
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006823   Gene: ENSFCAG00000007356   Transcript: ENSFCAT00000007358
Sequence length 440
Comment pep:novel genescaffold:CAT:GeneScaffold_2526:6769:59833:-1 gene:ENSFCAG00000007356 transcript:ENSFCAT00000007358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDGLQACTDPGVPENGFRTPSGGVFPESSVTQFHCEDGFKLKGSTKRLCVRHPNGTLGWI
PSDKPVCAREDCRVPQVEDAEIRNKTYRHGDKLIVTCHEGFKIRYPDLHNMVSLCRDDGT
WDNLPLCQGCLRPLSSSNGYVNISEFQTSFPVGTVISYHCFPGFKLEGSEYLECLHNLIW
SSSPPRCLALEAPVCPLPPTVSHGDSVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYLT
CQDGQWFPSYQVHCVKSEQTWPSTHETLLTTWKVVAFTATSVLLVLLLVILARMFQTKFK
AHFPVRGPPRSSSSDPDFVVVDGVPVMLPSYDEAVSGSLRASGPGYLGSVGPGCPLPVDD
QSPPAYPGSGDTDTGPGGSEPCDGVSGSSEPLQSLYSPSACPGGPRPDSADTGAGSARET
ASSSPGIDIADEIPLMEEDA
Download sequence
Identical sequences 9685.ENSFCAP00000006823 ENSFCAP00000006823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]