SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007259 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007259
Domain Number 1 Region: 17-264
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.35e-72
Family Eukaryotic proteases 0.0000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007259   Gene: ENSFCAG00000007839   Transcript: ENSFCAT00000007841
Sequence length 282
Comment pep:novel genescaffold:CAT:GeneScaffold_701:172691:176935:-1 gene:ENSFCAG00000007839 transcript:ENSFCAT00000007841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPQANELGRLLLAVSVALTLPTGPPAGSRGARIIGGHEVKPHSRPYMVSVAFEGQHHCG
GFLLRSRWVVSAAHCFSHRDSRMGLVVLGAHVLHSSEPTRQVLGISTVVRHPDYQPTTHA
NDICLLQLNGSAILGPAVGLLRLPRRDATPLRAGARCRVAGWGSVSDFEDLPPGLMEAEV
RVLGLDVCNSSWKGQLSPAMLCTHSGDRRRRGFCSADSGGPLVCRNRAHGLVSFSGLWCG
DPKTPDVYTQVSAFVSWIQDVVRRNGPQPSPLPGTAGFAGVA
Download sequence
Identical sequences ENSFCAP00000007259 9685.ENSFCAP00000007259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]