SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007439 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007439
Domain Number 1 Region: 455-564
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-28
Family SPRY domain 0.0035
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 7.83e-18
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 3 Region: 149-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000275
Family B-box zinc-binding domain 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000007439
Domain Number - Region: 202-285
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0122
Family ABC transporter ATPase domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007439   Gene: ENSFCAG00000008031   Transcript: ENSFCAT00000008032
Sequence length 565
Comment pep:novel genescaffold:CAT:GeneScaffold_5016:218449:245252:-1 gene:ENSFCAG00000008031 transcript:ENSFCAT00000008032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVPLAEELSCSICLEHFKVPVTTPCGHNFCSSCLDETWAVQEPPYLCPQCRASYQER
PQLHKNTVLCAVVEQFLQAEVARVAPSPPDGCTPPARAAEPSPPCQVACDHCLKAPAVKT
CLVCMASFCQEHLQPHLDSPAFRDHQLQPPVKDLMRRKCPQHNRLRDFFCPQHDECICHI
CLVEHKACSPETLSQASADLQTKLKHKLTIICDQINGASRALEDVRARQQDIRTARRKTE
QLRQEYVEIKILIDAAEAICTRKIKEEQKRVSTKFDNIYQILLKNKSEIQTLKEEIELAL
TKEDEFEFLEKAIKLQGISTKPVYVPKMELNQELIKGVCQGTSDLKNELKRYIRLPQDKK
PEGPAGSGNLGEHGPASTHKPAHFVKKVLKEEKKHKKPPTASASPVNMPTFGAPEQLLGL
KQAGLETVAKASAVQPNPVSLTTKVLDTFLAKSRPELLEYATKFSLDYNTAHNKVALLEN
YTVASVADLPLNYQPHPKRFTYCSQVLGLHYYRKGIHYWEVELQKNNFCGVGICYGSMPR
QGPDSRLGRNSASWCVEWFNTKVSA
Download sequence
Identical sequences 9685.ENSFCAP00000007439 ENSFCAP00000007439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]