SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007479 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007479
Domain Number 1 Region: 395-492
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.99e-32
Family Eukaryotic proteases 0.0087
Further Details:      
 
Domain Number 2 Region: 234-304
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000000306
Family Eukaryotic proteases 0.0067
Further Details:      
 
Domain Number 3 Region: 112-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007479   Gene: ENSFCAG00000008071   Transcript: ENSFCAT00000008073
Sequence length 495
Comment pep:novel genescaffold:CAT:GeneScaffold_4303:139858:201860:-1 gene:ENSFCAG00000008071 transcript:ENSFCAT00000008073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNSGPPPGVGPFYENHGYQPEGLYPPRPAVVPGAYSVYPAPYYPPAVPQYAPRVLTHA
STPSSHTQPKSPSGTVCTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENKCLVSGIEC
GSSGTCVSPSHWCDGVLHCPSGEDENRCVRLYGPNFILQVXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXNSFYSSHGVADDSGATSFMRVNTSANHMDLYKKLYHSDVCSSKTVVSLR
CIXXXXXXXXXAKMGRQRRNVGGSSAPREDPWQASLHVQGVQVCGGSIISPEWIVTAAHC
VEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTSDELNAVMVPLIEPWRCNSKYVYN
NLVTPAMICAGYLQGTIDSCQGDSGGPLVTMKSHIWWLIGDTSWGSGCAKANRPGVYGNV
TVFTDWIYRQMRANG
Download sequence
Identical sequences ENSFCAP00000007479 9685.ENSFCAP00000007479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]