SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007518 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007518
Domain Number 1 Region: 196-437
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-60
Family Eukaryotic proteases 0.00025
Further Details:      
 
Domain Number 2 Region: 49-94
Classification Level Classification E-value
Superfamily SEA domain 0.0000000602
Family SEA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007518   Gene: ENSFCAG00000008114   Transcript: ENSFCAT00000008116
Sequence length 438
Comment pep:novel genescaffold:CAT:GeneScaffold_4759:38777:124816:-1 gene:ENSFCAG00000008114 transcript:ENSFCAT00000008116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMYAPVEFSEVDYPQVEYQRRQQFWDPIRLALFTLAIVAIIGIAIGIVTHFVVEDDKSFY
YLASFKVTNIKYKENYGMKSSREFIERSHQIERMXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDSKRMRN
LLNSRCGIRMTSSNMPLPASSSTERIVQGRETAMEGEWPWQASLQLIGSGHQCGATLISN
TWLLTAAHCFRKNKDPSQWIATFGTTITPPAVQRSLGKIILHENYHRETNENDIALAQLT
NRVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGDSGGPLVYDNHDIWYLVGIVSWGQSCALPKKPG
VYTRVTQYRGWIASKTGI
Download sequence
Identical sequences ENSFCAP00000007518 9685.ENSFCAP00000007518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]