SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007580 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007580
Domain Number 1 Region: 14-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-67
Family Eukaryotic proteases 0.0000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007580   Gene: ENSFCAG00000008180   Transcript: ENSFCAT00000008182
Sequence length 259
Comment pep:novel genescaffold:CAT:GeneScaffold_2637:40542:48056:1 gene:ENSFCAG00000008180 transcript:ENSFCAT00000008182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNSYTFLASSLLIAIFLLLIPGDFCVKIIGGNQVTPHSRPYMVLLKGESICAGALIEKN
WVLTAAHCVLNRTSQVILGAHSITKNEPEKQIMFVKKQYPYPCFDQDTHEGDLKLLQLTK
KAKINKNVSTLRLPKKGDDVKPGTMCQVAGWGKIHNNSPQSDTLREVNITVINRRICNDQ
KHYDYHPVIGLNMICAGSLKGGKDSCNGDSGSPLICEGTYRGITAFGLPGKCGDPRGPGI
YTLLSQKYLNWINKTMKAV
Download sequence
Identical sequences ENSFCAP00000007580 9685.ENSFCAP00000007580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]