SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007595 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007595
Domain Number 1 Region: 2-224
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.24e-65
Family Eukaryotic proteases 0.000000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007595   Gene: ENSFCAG00000008194   Transcript: ENSFCAT00000008197
Sequence length 226
Comment pep:novel scaffold:CAT:scaffold_144573:76228:78035:-1 gene:ENSFCAG00000008194 transcript:ENSFCAT00000008197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EITSGIESKPHPCPYMAQLEIITDQGYVASCGGFLVSQEFVMTAAHCKGRKITVTMGSHD
IKQEESTWQKLEVSEQIVHPNYNFFTNLNDIMLLKLQTRAKLTHAMGTIPCPWSTFIPPG
RMCRAAGWGRTGVMKPVSDTLREVKLRLMDAKACNHYTFYSHKLQICVDNPRKTRSAYKG
DSGGPLFCAGVAQGIVSYGRTDAKPPAVFTRISPYVPWINKILKKQ
Download sequence
Identical sequences ENSFCAP00000007595 9685.ENSFCAP00000007595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]