SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007658 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007658
Domain Number 1 Region: 31-253
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.33e-64
Family Eukaryotic proteases 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007658   Gene: ENSFCAG00000008263   Transcript: ENSFCAT00000008263
Sequence length 254
Comment pep:novel scaffold:CAT:scaffold_155879:42995:50149:-1 gene:ENSFCAG00000008263 transcript:ENSFCAT00000008263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRAGNPWGWFLGYLVLGVTGSQASGGGNHIINGEDCIPHSQPWQAALFTEDEFFCGGVL
VHPQWVLSAAHCFQKSYTIGLGLHSLEASQEPGSLMMEANFSIQHPEYNKPFIANDLMLI
KLKESVPGSDAIQNISIASQCPTSGDSCLVSGWGQLMTGRQPQVLQCVNISVVPEEICXX
XXXXXXXXXXXXXXXXXXXXXXXXGDSGGPLVCNGSLQGLVSFGQVQCGQPYVPSVYTNL
CKFTDWIQKTIQDN
Download sequence
Identical sequences 9685.ENSFCAP00000007658 ENSFCAP00000007658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]