SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007662 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007662
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.52e-81
Family Eukaryotic proteases 0.0000000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007662   Gene: ENSFCAG00000008266   Transcript: ENSFCAT00000008267
Sequence length 243
Comment pep:novel scaffold:CAT:scaffold_155879:80726:87327:-1 gene:ENSFCAG00000008266 transcript:ENSFCAT00000008267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKTLVVLILMAAAWAEEQNKVLHGGPCEQTSHPYQAALYTSDHLLCGGVLIHPLWVLTAA
HCKKPNLQVYLGKHNLQQRESFQEQSSVVRAVVHPGYNAATHDQDIMLLRLSHPAKFSER
IQPLPLEQDCSANHTSCHILGWGKTADGGFPNTIQCAYIHLVSHEECERAYPSQITRNMV
CAGDEKYGKDSCQGDSGGPLVCGDRLRGLVSWGNVPCGSKEKPGVYTDVCRYGHWIRKTI
QAN
Download sequence
Identical sequences ENSFCAP00000007662 9685.ENSFCAP00000007662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]