SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007724 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007724
Domain Number 1 Region: 25-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.47e-85
Family Eukaryotic proteases 0.000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007724   Gene: ENSFCAG00000008331   Transcript: ENSFCAT00000008332
Sequence length 261
Comment pep:novel scaffold:CAT:scaffold_4332:713:5161:-1 gene:ENSFCAG00000008331 transcript:ENSFCAT00000008332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFLVLCLALSLAGAGAAPPIQSRIIGGWDCRKNSQPWQAALYHYSKFQCGGVLVHPQWV
LTAAHCINDNYQLWLGRHNLFEHEDTAQFVQVSGSFPHPGFNLSLLENHTRLPGEDYSHD
LMLLRLAEPAQITDAVRVLDLPTQEPQVGSTCYASGWGSIEPDKFTYPDDLQCVDLKLLS
NNVCAKAHSQKVTEFMLCAGYLEGGKDTCVGDSGGPLICNGMFQGITSWGYIPCGSPNMP
AVFTKVISHLEWIRETMTANP
Download sequence
Identical sequences M3W990
ENSFCAP00000007724 XP_019674187.1.62641 9685.ENSFCAP00000007724 ENSFCAP00000007656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]