SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007789 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007789
Domain Number 1 Region: 543-719,767-817
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.93e-66
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 334-395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000327
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 3 Region: 232-316
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000942
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Domain Number 4 Region: 482-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000956
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 518-554
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000319
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 447-480
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000089
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000007789
Domain Number - Region: 72-109
Classification Level Classification E-value
Superfamily SEA domain 0.0017
Family SEA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007789   Gene: ENSFCAG00000008400   Transcript: ENSFCAT00000008402
Sequence length 818
Comment pep:novel genescaffold:CAT:GeneScaffold_4506:41205:89249:-1 gene:ENSFCAG00000008400 transcript:ENSFCAT00000008402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTAEAPQAAGGQGDGGDGEEAEPEGMFKAPKDSKRKVRDYLRLAPLWLALVVLASVGVL
LWYFLGYKAEVTVSQVYSGSLRVLNRHFSQDLARRESSAFRSETAKAQRMXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXCYRYSFVGQGQVQRLKGPDHLASSCLWHLQG
PKDLMLKLRLEWTLAECRDRLAMYDVAGPLERRLITSVYGCSRQEPVVEVLASGAVMAVV
WKKGLHSYYDPFVLSVQPVAFQACEVNLTLEGRLEPQGVLSTPYFPSYYSPSTHCSWNLM
VPSLDYGLALWFDAYALRRQRYDLPCTQGQWTIQNRXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXCPGEFLCSVNGLCVPCDGVKDCPNGLDERNCVCR
ATFQCQEDSTCISLSRICDRQPDCLNGSDEEQCQGGVPCGTFTFQCEDRSCVKKPNPQCD
GLPDCRDGSDEQHCDCGLQGPSGRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRWV
ITAAHCFQEDSMASPALWTVFLGKVWQSSRWPGEVSFKVSRLLLHPYHEEDSHDYDVALL
QLDHPVVRSPAVRPVCLPARSHFFEPGLHCWITGWGALREGARRVAITVFYGWGNGTETF
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDSGGPLVCKEPSG
RWFLAGLVSWGLGCGRPNYFGVYTRITGVIGWIQQVLS
Download sequence
Identical sequences ENSFCAP00000007789 9685.ENSFCAP00000007789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]