SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007819 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007819
Domain Number 1 Region: 877-942
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 594-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 412-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000818
Family Reprolysin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007819   Gene: ENSFCAG00000008431   Transcript: ENSFCAT00000008435
Sequence length 1113
Comment pep:novel genescaffold:CAT:GeneScaffold_2648:208:236172:1 gene:ENSFCAG00000008431 transcript:ENSFCAT00000008435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTHICCCCLLYQLGVLSNGIVSGGAGGGGGSLTPAAGTSREVRSVAPASPGEPADVHS
APRSPQPPSPPSGEDEEFESQELPRGSRGAAALSPGAPVSWHSPHPRLYSTSHPAQESSD
ADHVLLHILAFSPALYLLLRRDGRFLAPRFGMEQRPSPGPVPTLAAAARRPPAPPDASCF
YTGAVLQHPGSLASFSTCGGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIAYLSGMCS
EKRKCIIAEDNGLNLAFTIAHEMGHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSKASSCLLQTNPQSVNSVMVPSKLPGMTYTADEQCQILFGPLASFCQ
EMQXXXXXXXXXXXXGEKECRTKLDPPMDGTDCDAGKWCKAGECTTRTSAPEHVAGEWSM
WSPCSRTCSSGISSRERKCPGLGSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYS
VRTSYPKHGLQWQAVMDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGYQGLDVCANGRC
QKVGCDGFLGSLAREDHCGVCNGNGKSCKIIKGDFNHTRGAXXXXXXXXXXXXXXXXXXX
XXXAHSYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ERKTTVSCTKIMNKNISIVDNKKCKYLTKPEPQIRKCNEQPCQTRWMMTEWTPCSRTCGK
GMQSRQVACTQQLSNGTLIRARERDCFGPKPASAQRCEGQDCMTVWEAGVWSEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALTFKCLGDQWPVYCR
VIREKNLCQDMRWYQRCCETCRDFYAQKLQQKS
Download sequence
Identical sequences ENSFCAP00000007819 9685.ENSFCAP00000007819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]