SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007877 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007877
Domain Number 1 Region: 206-449
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.12e-86
Family Eukaryotic proteases 0.0000906
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-17
Family Hepsin, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007877   Gene: ENSFCAG00000008495   Transcript: ENSFCAT00000008498
Sequence length 453
Comment pep:novel genescaffold:CAT:GeneScaffold_3585:45160:60147:-1 gene:ENSFCAG00000008495 transcript:ENSFCAT00000008498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMPDGQAHMEPQYAEEGPGPGIFRAEPGDQQQPTSRAGRWCSRRRGCVGLGTLALLAG
ASVGSWLLVLYLWPAASQPSPGNLQDEEMPLSCSEASGEEALLPSLPRTVSFRINPEGFL
LAVQVRARPDWLLVCHEGWSSALGLRICQSLGHLRLTHYKGVNLSDIQLNSSQGFAQLSP
GLGGFLEEVWQPRDSCASGQIVSLRCSECGTRPLASRIVGGQAVAPGRWPWQASVALGSR
HTCGGSVLAPRWVMTAAHCMHSFRLSRLSSWRVYTGLVSHSAVRPHQGAMVEKIIPHPLY
STQNHDYDVALLQLRTPLHFSDTVGAVCLPAEKQDFPRGSQCWVSGWGHTDPHNSDTLQD
TVVPLLGTRLCNSSCMYSGALTPRMLCAGYVDGRADACQGDSGGPLVCLDGGTWHLVGVV
SWGRGCAEPNHPGVYAKVAEFLDWIHDTARDVV
Download sequence
Identical sequences ENSFCAP00000007877 9685.ENSFCAP00000007877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]