SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007879 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007879
Domain Number 1 Region: 557-609
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000497
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 409-467
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000188
Family Reprolysin-like 0.0088
Further Details:      
 
Domain Number 3 Region: 808-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000392
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 869-925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000837
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 983-1034
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 928-983
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000007879
Domain Number - Region: 247-282
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00733
Family Reprolysin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007879   Gene: ENSFCAG00000008498   Transcript: ENSFCAT00000008500
Sequence length 1083
Comment pep:novel genescaffold:CAT:GeneScaffold_1650:86099:444974:-1 gene:ENSFCAG00000008498 transcript:ENSFCAT00000008500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEILWKTLTWILSLIMASSECHSDHRLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFT
VKNDKHSRRRRSMDPIDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDG
PQWKHDFLDNCHYTGYLQDQRSTTKVALSNCIGLXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIRSGKPWWLNDTSTFPSSLPINGTHIRH
RQKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMNIXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGMNHDGIGNSC
GTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAP
GQVYDADEQCRFQYGATSRQCKYGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
WCYQGDCVPFGTWPQSIDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLGE
RKRYRSCNTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVGCDNILGSDAREDRCRVCGGDGSTCDAIE
GFFNDSLPRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGRGTWVSQWVKSPTSLVMVL
LQEQNLGIRYKFNVPITRTGSGDNEVGFTWNHQPWSECSATCAGGVQRQEAVCKRLDDNS
IVQNNYCDPDSKPPENQRACNTEPCPPEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSE
EETLDYSGCLTHRPIEIESCNNQSCPPQWVALDWSECTPKCGPGFKHRIVLCKSSDLSKT
FPAAQCPEENKPPVRIRCSLGRCPPPRWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASS
DCPETVRPPSMQQCESKCDSTPISNTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTC
QGH
Download sequence
Identical sequences ENSFCAP00000007879 9685.ENSFCAP00000007879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]