SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008085 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008085
Domain Number 1 Region: 49-105
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000917
Family Lectin leg-like 0.014
Further Details:      
 
Domain Number 2 Region: 181-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000554
Family Lectin leg-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008085   Gene: ENSFCAG00000008721   Transcript: ENSFCAT00000008723
Sequence length 357
Comment pep:novel genescaffold:CAT:GeneScaffold_5018:15475:60688:-1 gene:ENSFCAG00000008721 transcript:ENSFCAT00000008723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLGPSGWWQRWRRRLSAWNGSRMLLLLLLLGSGQGPRQVGAGQTFEYLKREHSLSKP
YQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPFLRDWEQVHXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQKRRYSPGVQRV
FPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHDVISLKLFELTVERTPEEEKLHRDVFL
PSVDNMKLPEVTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY
Download sequence
Identical sequences ENSFCAP00000008085 9685.ENSFCAP00000008085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]