SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008232 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008232
Domain Number 1 Region: 275-517
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.68e-86
Family Eukaryotic proteases 0.00000000366
Further Details:      
 
Domain Number 2 Region: 163-269
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000889
Family Hepsin, N-terminal domain 0.00000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008232   Gene: ENSFCAG00000008882   Transcript: ENSFCAT00000008883
Sequence length 529
Comment pep:novel genescaffold:CAT:GeneScaffold_4070:94925:116473:1 gene:ENSFCAG00000008882 transcript:ENSFCAT00000008883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQVPSSHLLPQIQTFSPLLTKAQARGPPTLQQASPGCWSDTDPILEPGPICVPDHGVLWP
GPSPSSLPGWAPGTGGTGLGSAPPGPASRFISPQVPPRPRKSAGESLTRGRDMAEKEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXAASWAIVTFLLKSDQEPLYPVQVSPADSRLMVFDD
TEGTWRLLCSSRSNAGVAGLGCEDMGFLRALGHSELDVRTAGANGTSGFFCVDEGRLPLA
RRLLEVISVCDCPRGRFLATVCQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLC
GGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRD
PNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGV
LQEARVPIISNDVCNGPDFYANQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPR
WRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences 9685.ENSFCAP00000008232 ENSFCAP00000008232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]