SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008331 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008331
Domain Number 1 Region: 232-302
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-18
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 2 Region: 64-130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000034
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 3 Region: 137-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 185-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008331   Gene: ENSFCAG00000008987   Transcript: ENSFCAT00000008989
Sequence length 765
Comment pep:novel genescaffold:CAT:GeneScaffold_3458:350080:412231:-1 gene:ENSFCAG00000008987 transcript:ENSFCAT00000008989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGALAEHSENVHISGVSTACGETPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXFQDFDIQGSRRCSLDWLTIETYKNIESYRACGSTVPPPYISSQDHVWIRFHSDDSI
SRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIPEAWKCNNMDECGDSSDEEICAKEAGPP
TAASFQPCAYNQFQCLSRFTKVYTCLPESLKCDGNIDCLDLGDEIDCDVPTCGQWLKYFY
GTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILRFTDFKLDGTGYGDYVKIYDGLEENPHK
LLRVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSFETQLSRVEAELLRREAPPSYGQLIAQGLIPPVEDFPVC
SPNQASVLENLRLAVRSQLGFTSIRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDE
VVPSQSTSREPERSHAHRSLFSVESDDTDTENERRDTAGASGGVAAPLPQKVPPTTAVEA
TVGASGSSSTQSTRGGHTDSGRDVTSVEPPGVSPARHQLTSALSRMTQGLRWVRFTLGRS
SSVNQNQSPLRQLDNGANGREEDDDVEMLIPVSDGASDLDVNDCS
Download sequence
Identical sequences 9685.ENSFCAP00000008331 ENSFCAP00000008331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]