SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008700 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008700
Domain Number 1 Region: 84-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-25
Family Laminin G-like module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008700   Gene: ENSFCAG00000009383   Transcript: ENSFCAT00000009385
Sequence length 1619
Comment pep:novel genescaffold:CAT:GeneScaffold_4767:155449:231456:-1 gene:ENSFCAG00000009383 transcript:ENSFCAT00000009385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRRGLSQPRAGLCLLLASLQLLLRTQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGHFPENFSVLITLRGQPANESVLLSIYDEGGARQLGL
ALGPALGLLGDSFSPLPQQVNLMDGRWHRVAISVDGRMVTLVADCEPQPPTLGQGPRFIS
TAGLTVLGTQDLGEETFEGDIQELLISPDPQAAFQACERYLPGCDNLDPVATGAPQGEPE
TPAPRRRKGKGKGKKKGRGRKGKGRKKKKNKETLTPSLPPGSLENQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGAGEKGAKGEPAVIEQGQQFEGPPGAPGPRGVVGPSGPPGPPGFPGD
PGLPGPAGLPGIPGIDGIRGLPGTVIMMPFQFASSSLKGPPVSFQQAQAQAVLQQAQLSM
KGPPGPVGLTGRPGPVGLPGYPGQKGEMGEMGPQGPRGLQGPLGPPGREGKMGRSGADGA
RGLPGDTGPKGDRGFDGLPGLPGEKGQRGDFGHVGQPGPPGEDGEKGAEGPPGPTGQAGE
PGPRGLIGPRGSPGPLGRPGVLGIDGAPGAKGNVGPPGEPGPPGQQGNPGSQGLPGPQGP
IGTPGEKGPPGNPGIPGIQGSDGPPGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGT
SGNRGLQGEKGEKGEDGFPGFKGDGGLKGDRGPPGPPGPRGEDGPEGLKGQEGLAGEEGP
PGSAGEKGKLGLPGLPGYPGRPGPKGSAGFPGPLGPLGEKGKRGKAGQPGLEGERGPPGS
RGDRGQPGPTGQPGPKGDVGQDGASGIPGEKGLPGLQGPPGFPGPKGPPGPQGKDGRPGH
PGQRGELGFQGQTGPPGPAGVVGPQGKTGEAGPLGERGPPGPPGPPGEQGLPGLEGREGV
KGDLGPPGPLGKEGPPGPRGFPGPQGAPGDPGPIGLKGDKGPLGPVGANGPPGERGPVGP
AGGMGLPGQSGGQGPVGPAGEKGSPGERGSPGPTGKDGIPGPLGLPGPPGAVGPSGEDGD
KGEVGAPGNKGSKGDKGDAGPPGPTGVRGPVGHPGSPGADGAQGRRGPPGLFGQKGDDGV
RGFVGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPHGPSGSEGPPGLPGGVGQ
PGAVGEKGEPGEAGDPGPPGTPGIPGPKGEIGEKGDSGPSGAAGPPGKKGPPGEDGVKGN
VGPTGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEAGPPGPPGKRGPSGR
MGPEGKEGEKGAKGEPGPDGPPGMTGPVGARGPPGRVGPEGLRGIPGPVGEPGLLGPPGM
MGPPGPLGPSGLPGLKGDAGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGPKGE
PGPPGPIGSLGPPGPPGVAGPLGQKGSKGSPGSFGPRGDTGPPGPPGPPGPPAELHGLRR
RRRRSVPLEGPEGGLEEVLASLTSLSFELEQMRRPPGTAERPGLVCSELHRNHPHLPDGE
YWIDPNQGCARDALRVFCNFTAGGETCLYPDKKFETVKMASWSKEKPGNWYSTFRRGKK
Download sequence
Identical sequences ENSFCAP00000008700 9685.ENSFCAP00000008700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]